Loading...
Statistics
Advertisement

vesrah.com
www.vesrah.com/

Vesrah.com

Advertisement
Conversion Technology Metas Server
Vesrah.com is hosted in Japan / Itoman . Vesrah.com doesn't use HTTPS protocol. Number of used technologies: 3. First technologies: Html, Iframe, Swf Object, Number of used javascripts: 1. First javascripts: Mm_menu.js, Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Vesrah.com

Technology

Number of occurences: 3
  • Html
  • Iframe
  • Swf Object

Advertisement

Javascripts

Number of occurences: 1
  • mm_menu.js

Server Type

  • Apache

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Vesrah.com

Missing HTTPS protocol.

    Meta - Vesrah.com

    Number of occurences: 3
    • Name:
      Content: text/css
    • Name: GENERATOR
      Content: Microsoft FrontPage 4.0
    • Name: ProgId
      Content: FrontPage.Editor.Document

    Server / Hosting

    • IP: 203.138.102.223
    • Latitude: 26.12
    • Longitude: 127.67
    • Country: Japan
    • City: Itoman

    Rname

    • ns3.sphere.ad.jp
    • ns4.sphere.ad.jp
    • vesrah.com

    Target

    • hostmaster.suite.arena.ne.jp

    HTTP Header Response

    HTTP/1.1 200 OK Date: Sun, 05 Jun 2016 21:33:41 GMT Server: Apache Content-Type: text/html X-Cache: MISS from s_bd39 X-Cache-Lookup: MISS from s_bd39:80 Via: 1.1 s_bd39 (squid/3.5.19) Connection: keep-alive

    DNS

    host: vesrah.com
    1. class: IN
    2. ttl: 86400
    3. type: A
    4. ip: 203.138.102.223
    host: vesrah.com
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: ns3.sphere.ad.jp
    host: vesrah.com
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: ns4.sphere.ad.jp
    host: vesrah.com
    1. class: IN
    2. ttl: 86400
    3. type: SOA
    4. mname: ns3.sphere.ad.jp
    5. rname: hostmaster.suite.arena.ne.jp
    6. serial: 1058404498
    7. refresh: 86400
    8. retry: 21600
    9. expire: 2419200
    10. minimum-ttl: 3600
    host: vesrah.com
    1. class: IN
    2. ttl: 4726
    3. type: MX
    4. pri: 10
    5. target: vesrah.com

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.esrah.com, www.vyesrah.com, www.yesrah.com, www.vzesrah.com, www.zesrah.com, www.vhesrah.com, www.hesrah.com, www.vnesrah.com, www.nesrah.com, www.vmesrah.com, www.mesrah.com, www.vjesrah.com, www.jesrah.com, www.vkesrah.com, www.kesrah.com, www.viesrah.com, www.iesrah.com, www.vsrah.com, www.vexsrah.com, www.vxsrah.com, www.vessrah.com, www.vssrah.com, www.vewsrah.com, www.vwsrah.com, www.versrah.com, www.vrsrah.com, www.vefsrah.com, www.vfsrah.com, www.vevsrah.com, www.vvsrah.com, www.vecsrah.com, www.vcsrah.com, www.veqsrah.com, www.vqsrah.com, www.veasrah.com, www.vasrah.com, www.veysrah.com, www.vysrah.com, www.verah.com, www.veserah.com, www.veerah.com, www.veswrah.com, www.vewrah.com, www.vesdrah.com, www.vedrah.com, www.vesxrah.com, www.vexrah.com, www.vesfrah.com, www.vefrah.com, www.vesgrah.com, www.vegrah.com, www.vestrah.com, www.vetrah.com, www.vesah.com, www.vesriah.com, www.vesiah.com, www.vesroah.com, www.vesoah.com, www.vesrlah.com, www.veslah.com, www.vesrlah.com, www.veslah.com, www.vesr.ah.com, www.ves.ah.com, www.vesrh.com, www.vesraoh.com, www.vesroh.com, www.vesraph.com, www.vesrph.com, www.vesra9h.com, www.vesr9h.com, www.vesrah.com, www.vesrh.com, www.vesraih.com, www.vesrih.com, www.vesrauh.com, www.vesruh.com, www.vesra.com, www.vesrahe.com, www.vesrae.com, www.vesrahd.com, www.vesrad.com, www.vesrahc.com, www.vesrac.com, www.vesrahu.com, www.vesrau.com, www.vesrahj.com, www.vesraj.com, www.vesrah.com, www.vesra.com, www.vesrahb.com, www.vesrab.com, www.vesrahg.com, www.vesrag.com,

    Other websites we recently analyzed

    1. selfreliantlivingmarketplace.com
      Scottsdale (United States) - 184.168.221.96
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    2. Agence web, création de sites internet à Paris
      Agence web à Paris Studio de conception et réalisation de sites internet, Paris Web Studio est une agence de communication digitale au service des entreprises
      France - 37.187.65.16
      Server software: Apache
      Technology: CSS, Font Awesome, Html, Html5, Javascript, jQuery, Php, Pingback, Revslider, Google Analytics, Wordpress
      Number of Javascript: 18
      Number of meta tags: 10
    3. MoDem78 | Mouvement Démocrate des Yvelines
      France - 213.186.33.82
      Server software: Apache
      Technology: CSS, Google Font API, Html, Html5, Iframe, Javascript, jQuery, Php, Pingback, Google Analytics, Wordpress, Facebook Box
      Number of Javascript: 9
      Number of meta tags: 3
    4. å¾·é›…
      Hangzhou (China) - 202.91.248.229
      Server software: IIS
      Technology: CSS, Html, Javascript
      Number of Javascript: 5
      Number of meta tags: 4
    5. www.giannitrapani.biz
      Arezzo (Italy) - 62.149.132.182
      Server software: Apache
      Technology: Html
      Number of meta tags: 1
    6. nefigasi.com
      Krasnodar (Russian Federation) - 212.192.128.21
      Server software: Apache/2.2.22 (Ubuntu)
      Technology: Html
      Number of meta tags: 1
    7. My Kinda Travel
      My Kinda Travel | Beach Breaks | Ski Deals | Lakes & Mountains Holidays
      United Kingdom - 62.73.160.215
      Server software: Apache
      Technology: CSS, Html, Javascript, Google Analytics
      Number of Javascript: 9
      Number of meta tags: 2
    8. 池田のりはる（池田徳晴）公式WEBサイト | 池田のりはる（池田徳晴）公式WEBサイト
      Japan - 203.189.105.206
      Server software: Apache
      Technology: CSS, Html, Html5, Iframe, jQuery, jQuery Cycle, Php, Pingback, Wordpress, Facebook Like box, Facebook Box
      Number of Javascript: 7
      Number of meta tags: 4
    9. MBA Systems
      United Kingdom - 195.35.124.19
      Server software:
      Technology: CSS, Html
      Number of meta tags: 1
    10. Villa Anita - Cala Murada - Spain
      Dublin (Ireland) - 54.228.216.179
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Flexslider, Html, Html5, Iframe, Javascript, Php, Signal
      Number of Javascript: 2
      Number of meta tags: 4

    Check Other Websites